Structure of PDB 8htu Chain J

Receptor sequence
>8htuJ (length=41) Species: 3218 (Physcomitrium patens) [Search protein sequence]
MQDVKTYLSTAPVLATLWFGFLAGLLIEINRFFPDALVLPL
3D structure
PDB8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.
ChainJ
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J Y7 A11 P12 F19 Y7 A11 P12 F19
BS02 CLA J D35 A36 D35 A36
BS03 CLA J L14 W18 L14 W18
BS04 CLA J W18 F19 L22 W18 F19 L22
BS05 CLA J F21 G24 E28 R31 F32 F21 G24 E28 R31 F32
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum8htu
PubMed37474782
UniProtQ6YXM2|PSAJ_PHYPA Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]