Structure of PDB 8hil Chain J |
>8hilJ (length=64) Species: 3712 (Brassica oleracea) [Search protein sequence] |
MIIPVRCFTCGKVIGNKWDTYLDLLQADYTEGDALDAIGLVRYCCRRMLM THVDLIEKLLNYNT |
|
PDB | 8hil Structure and mechanism of the plant RNA polymerase V. |
Chain | J |
Resolution | 3.57 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C10 R42 |
C10 R42 |
|
|
|
|