Structure of PDB 8h0v Chain J |
>8h0vJ (length=66) Species: 460519 (Komagataella phaffii) [Search protein sequence] |
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVL THVDLIEKFLRYNPLE |
|
PDB | 8h0v Structural basis of RNA polymerase II transcription on the chromatosome containing linker histone H1. |
Chain | J |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C7 C10 C44 C45 |
C7 C10 C44 C45 |
|
|
|
|