Structure of PDB 8ec0 Chain J

Receptor sequence

>8ec0J (length=385) Species: 4932 (Saccharomyces cerevisiae)

MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFM
AMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKG
LYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNL
FSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMA
LHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNT
LGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAIL
VLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVL
MGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK

3D structure

• PDB: 8ec0 Structural insights into cardiolipin replacement by phosphatidylglycerol in a cardiolipin-lacking yeast respiratory supercomplex.
• Chain: J
• Resolution: 3.3 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.8: quinol--cytochrome-c reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PGT	J	R4 H222	R4 H222
BS02	HEM	J	Q43 G47 Y54 V65 R79 A86 F89 H183 Y184	Q43 G47 Y54 V65 R79 A86 F89 H183 Y184
BS03	HEM	J	W30 L36 H96 K99 W114 G117 H197 L201 S206 S207	W30 L36 H96 K99 W114 G117 H197 L201 S206 S207
BS04	UQ6	J	Q22 S34 V41 M221	Q22 S34 V41 M221

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain
• GO:0045333 cellular respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:8ec0, PDBe:8ec0, PDBj:8ec0
• PDBsum: 8ec0
• PubMed: 37188665
• UniProt: P00163|CYB_YEAST Cytochrome b (Gene Name=COB)