Structure of PDB 8d8l Chain J

Receptor sequence
>8d8lJ (length=144) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TRPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTG
YYLGIPLTGPKPLPTRRERWTVIKENFERHTHKRLIRAWDTNPEVLQMLI
AYITKHSMAGVGMKCNFFQRSEISSAVGQKVLELLDSPDFKKHL
3D structure
PDB8d8l Principles of mitoribosomal small subunit assembly in eukaryotes.
ChainJ
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J G39 N52 T74 P76 P78 L79 P80 T81 R82 R83 R85 K99 H107 K108 R109 L110 R112 K139 G23 N36 T58 P60 P62 L63 P64 T65 R66 R67 R69 K74 H82 K83 R84 L85 R87 K114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d8l, PDBe:8d8l, PDBj:8d8l
PDBsum8d8l
PubMed36482135
UniProtQ03201|RT10_YEAST Small ribosomal subunit protein uS10m (Gene Name=RSM10)

[Back to BioLiP]