Structure of PDB 8cdu Chain J

Receptor sequence
>8cduJ (length=108) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
QYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPLTL
TETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLL
TRDARMKE
3D structure
PDB8cdu Structural basis of ribosomal 30S subunit degradation by RNase R
ChainJ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J Y7 T9 R11 R12 K13 S14 R18 R20 G69 G70 G71 S73 Q75 R85 R95 K99 R100 L104 R106 A108 R109 M110 K111 E112 Y3 T5 R7 R8 K9 S10 R14 R16 G65 G66 G67 S69 Q71 R81 R91 K95 R96 L100 R102 A104 R105 M106 K107 E108
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cdu, PDBe:8cdu, PDBj:8cdu
PDBsum8cdu
PubMed38326618
UniProtP21470|RS9_BACSU Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]