Structure of PDB 8cdr Chain J

Receptor sequence

>8cdrJ (length=120) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETA
MKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA
YVRLTADYDALDIANRIGYI

3D structure

PDB

8cdr mRNA reading frame maintenance during eukaryotic ribosome translocation

Chain

Resolution

2.04 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T31 F32 R33 L34 P35 K36 K39 L40 R42 A43 P44 K45 Y46 S69 K75 N91 K92 Y93 K109 N111 T112 L113 V114 P116 K120 K121 Y123 R125	T9 F10 R11 L12 P13 K14 K17 L18 R20 A21 P22 K23 Y24 S47 K53 N69 K70 Y71 K87 N89 T90 L91 V92 P94 K98 K99 Y101 R103
BS02	rna	J	A23 P35 T37 L38 R42 S48 K49 H53 Y54 N55 R56 K61 K89 N91 Y93 Q94	A1 P13 T15 L16 R20 S26 K27 H31 Y32 N33 R34 K39 K67 N69 Y71 Q72

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cdr, PDBe:8cdr, PDBj:8cdr
PDBsum	8cdr
PubMed	38030725
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)