Structure of PDB 8c98 Chain J

Receptor sequence
>8c98J (length=132) Species: 562 (Escherichia coli) [Search protein sequence]
MKTFTAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDT
GDYIIVLNADKVAVTGNKRTDKVYYQATFEEMIARRPERVIEIAVKGMLP
KGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI
3D structure
PDB8c98 Cryo-EM captures early ribosome assembly in action.
ChainJ
Resolution3.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J K2 T3 K7 P8 E9 G26 R27 T30 K39 H47 T65 K68 K72 M108 L114 K2 T3 K7 P8 E9 G26 R27 T30 K39 H47 T65 K68 K72 M98 L104
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0048027 mRNA 5'-UTR binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c98, PDBe:8c98, PDBj:8c98
PDBsum8c98
PubMed36797249
UniProtP0AA10|RL13_ECOLI Large ribosomal subunit protein uL13 (Gene Name=rplM)

[Back to BioLiP]