Structure of PDB 8buu Chain J

Receptor sequence

>8buuJ (length=144) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

RTTPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDT
GDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKM
LELAIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG

3D structure

PDB

8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	R2 T4 N8 W16 G27 R28 S31 R38 K40 H48 H54 T66 G67 K68 K69 K73 Y76 R77 H78 T79 Q80 H81 P82 G83 L85 R88 K100 E103 A105 G108 M109 K112 S114 L115 R117 K121 H133 A135 Q136 K137 G145	R1 T3 N7 W15 G26 R27 S30 R37 K39 H47 H53 T65 G66 K67 K68 K72 Y75 R76 H77 T78 Q79 H80 P81 G82 L84 R87 K99 E102 A104 G107 M108 K111 S113 L114 R116 K120 H132 A134 Q135 K136 G144

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum	8buu
PubMed	36951104
UniProt	P70974\|RL13_BACSU Large ribosomal subunit protein uL13 (Gene Name=rplM)