Structure of PDB 8auv Chain J

Receptor sequence

>8auvJ (length=98) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

TFKRRNGGRNKHGRGHTKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVR
DVQEACAFETYTLPKLYLKMQYCVSCAIHSKVVRVRSVTDRRVREPPQ

3D structure

PDB

8auv Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.38 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T2 F3 K4 R5 R6 N7 G8 G9 R10 N11 H13 G14 R15 G16 H17 F20 K32 K34 K37 R38 F39 K70 V75 S76 I79 H80 K82 V86 R87 S88 R92 R93 R95 P98	T1 F2 K3 R4 R5 N6 G7 G8 R9 N10 H12 G13 R14 G15 H16 F19 K31 K33 K36 R37 F38 K69 V74 S75 I78 H79 K81 V85 R86 S87 R91 R92 R94 P97
BS02	ZN	J	C23 C26 C74 C77	C22 C25 C73 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links