Structure of PDB 8a5i Chain J

Receptor sequence

>8a5iJ (length=175) Species: 169963 (Listeria monocytogenes EGD-e)

NRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLD
SAVEELALITGQKPVITKAKNSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLVTVSLPRVRDFRGVSKKAFDGRGNYTLGVREQLIFPEIDYDQVSKVRG
MDVVIVTTAKSDEESHELLTQLGMP

3D structure

• PDB: 8a5i Structural basis for HflXr-mediated antibiotic resistance in Listeria monocytogenes.
• Chain: J
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K33 V35 N37 T38 G39 G41 T68 A70 K71 I74 G76 F77 I85 K88 K120 A121 F122 D123 R125 T129 G131 R133 R150 G151 M152 D153 V155	K32 V34 N36 T37 G38 G40 T67 A69 K70 I73 G75 F76 I84 K87 K119 A120 F121 D122 R124 T128 G130 R132 R149 G150 M151 D152 V154
BS02	rna	J	S24 M26 E27 Q63 K64 V66 I67 V89 T90 R92	S23 M25 E26 Q62 K63 V65 I66 V88 T89 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8a5i, PDBe:8a5i, PDBj:8a5i
• PDBsum: 8a5i
• PubMed: 36300626
• UniProt: Q927L9|RL5_LISMO Large ribosomal subunit protein uL5 (Gene Name=rplE)