Structure of PDB 7zyv Chain J

Receptor sequence
>7zyvJ (length=159) Species: 3562 (Spinacia oleracea) [Search protein sequence]
GVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACN
VGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLM
ASVPAGLLTVPFLENVNKFQNPFRRPVATTVFLVGTVVALWLGIGATLPI
DKSLTLGLF
3D structure
PDB7zyv High-resolution cryo-EM structures of plant cytochrome b 6 f at work.
ChainJ
Resolution2.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide J P7 K119 F120 Q121 P6 K118 F119 Q120
BS02 CLA J G136 V139 G135 V138
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane
GO:0045275 respiratory chain complex III

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zyv, PDBe:7zyv, PDBj:7zyv
PDBsum7zyv
PubMed36638176
UniProtP00166|PETD_SPIOL Cytochrome b6-f complex subunit 4 (Gene Name=petD)

[Back to BioLiP]