Structure of PDB 7z34 Chain J

Receptor sequence
>7z34J (length=164) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
RDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGI
RRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEH
IDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDT
VSWFKQKYDADVLD
3D structure
PDB7z34 Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
ChainJ
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J N20 S22 R51 R55 T56 F57 I59 A66 S97 A98 G103 F104 G105 D126 Y128 N11 S13 R42 R46 T47 F48 I50 A57 S88 A89 G94 F95 G96 D117 Y119
BS02 rna J R10 Q43 V46 H68 V69 T70 R72 R137 R141 N150 H152 R1 Q34 V37 H59 V60 T61 R63 R128 R132 N141 H143
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z34, PDBe:7z34, PDBj:7z34
PDBsum7z34
PubMed36097293
UniProtP0C0W9|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]