Structure of PDB 7y8a Chain J

Receptor sequence
>7y8aJ (length=42) Species: 173977 (Chroomonas placoidea) [Search protein sequence]
MDSNFLKYLSTAPVLLTVWLSFTAGLVIEANRFFPDMLYFPM
3D structure
PDB7y8a Structural basis and evolution of the photosystem I-light-harvesting supercomplex of cryptophyte algae.
ChainJ
Resolution2.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 KC2 J F40 P41 F40 P41
BS02 CLA J T23 A24 T23 A24
BS03 CLA J P13 L16 P13 L16
BS04 CLA J N31 F34 D36 M37 L38 N31 F34 D36 M37 L38
BS05 8CT J F40 P41 F40 P41
BS06 CLA J L16 W19 L16 W19
BS07 CLA J W19 T23 W19 T23
BS08 II0 J Y8 T17 I28 R32 Y8 T17 I28 R32
BS09 CLA J F22 G25 L26 E29 R32 F33 F22 G25 L26 E29 R32 F33
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y8a, PDBe:7y8a, PDBj:7y8a
PDBsum7y8a
PubMed36943796
UniProtA0A222AI55

[Back to BioLiP]