Structure of PDB 7xti Chain J

Receptor sequence

>7xtiJ (length=67) Species: 460519 (Komagataella phaffii) [Search protein sequence]

MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVL
THVDLIEKFLRYNPLEK

3D structure

PDB

7xti Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	J	C7 C10 C45	C7 C10 C45

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006383	transcription by RNA polymerase III
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005736	RNA polymerase I complex

External links