Structure of PDB 7vnm Chain J

Receptor sequence
>7vnmJ (length=43) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
LGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7vnm Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
ChainJ
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO J L20 V23 G27 L28 L14 V17 G21 L22
BS02 BCL J F31 A35 H39 F25 A29 H33
BS03 BCL J F31 S32 A35 H39 V42 W48 F49 F25 S26 A29 H33 V36 W42 F43
BS04 SPO J V34 A41 V28 A35
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vnm, PDBe:7vnm, PDBj:7vnm
PDBsum7vnm
PubMed35418573
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]