Structure of PDB 7uqz Chain J

Receptor sequence

>7uqzJ (length=171) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

KAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYT
VRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFG
FGIDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHK
TTKEDTVSWFKQKYDADVLDK

3D structure

PDB

7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.

Chain

Resolution

2.44 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K16 N20 S22 S48 F57 I59 R60 I65 A66 R94 N95 S97 A98 T99 G103 F104 G105 G124 D126 Y128 K142	K13 N17 S19 S45 F54 I56 R57 I62 A63 R91 N92 S94 A95 T96 G100 F101 G102 G121 D123 Y125 K139
BS02	rna	J	N7 M9 R10 Q43 T44 V46 T70 R72 G135 R137 R140 R141 R143 G149 N150 H152	N4 M6 R7 Q40 T41 V43 T67 R69 G132 R134 R137 R138 R140 G146 N147 H149

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
PDBsum	7uqz
PubMed	36864048
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]