Structure of PDB 7ukh Chain J

Receptor sequence
>7ukhJ (length=181) Species: 9606 (Homo sapiens) [Search protein sequence]
PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG
DSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYD
LNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRN
KDGVVTIEEFIESCQKDENIMRSMQLFDNVI
3D structure
PDB7ukh Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
ChainJ
Resolution2.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA J D135 N137 D139 S141 D146 D64 N66 D68 S70 D75
BS02 CA J D171 N173 D175 C177 E182 D100 N102 D104 C106 E111
BS03 CA J D219 N221 D223 V225 E230 D148 N150 D152 V154 E159
Gene Ontology
Molecular Function
GO:0005250 A-type (transient outward) potassium channel activity
GO:0005267 potassium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0015459 potassium channel regulator activity
GO:0044325 transmembrane transporter binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
GO:0046923 ER retention sequence binding
Biological Process
GO:0001508 action potential
GO:0005513 detection of calcium ion
GO:0006813 potassium ion transport
GO:0006936 muscle contraction
GO:0007165 signal transduction
GO:0007268 chemical synaptic transmission
GO:0008016 regulation of heart contraction
GO:0045163 clustering of voltage-gated potassium channels
GO:0060306 regulation of membrane repolarization
GO:0071805 potassium ion transmembrane transport
GO:0086009 membrane repolarization
GO:0086013 membrane repolarization during cardiac muscle cell action potential
GO:1901379 regulation of potassium ion transmembrane transport
GO:1903764 regulation of potassium ion export across plasma membrane
GO:1903766 positive regulation of potassium ion export across plasma membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0030425 dendrite
GO:0034702 monoatomic ion channel complex
GO:0045202 synapse
GO:0071193 Kv4.2-KChIP2 channel complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ukh, PDBe:7ukh, PDBj:7ukh
PDBsum7ukh
PubMed35597238
UniProtQ9NS61|KCIP2_HUMAN A-type potassium channel modulatory protein KCNIP2 (Gene Name=KCNIP2)

[Back to BioLiP]