Structure of PDB 7s81 Chain J |
>7s81J (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] |
KSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQV PSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCM VKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPET |
|
PDB | 7s81 Captured snapshots of PARP1 in the active state reveal the mechanics of PARP1 allostery. |
Chain | J |
Resolution | 3.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C295 C311 C321 |
C73 C89 C99 |
|
|
|
|