Structure of PDB 7pis Chain J

Receptor sequence

>7pisJ (length=114) Species: 272634 (Mycoplasmoides pneumoniae M129)

NVSSGIIHVSCSPNNTIVSASDPGGNVLCWASSGTMGFKGSRKKTPYSAG
IAADKVAKTVKEMGMATVKLFVKGTGRGKDTAIRSFANAGLSITEINEKT
PIPHNGCKPPKRPR

3D structure

• PDB: 7pis Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: J
• Resolution: 15.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	H15 S19 P20 N21 N22 I24 S26 G32 N33 V34 L35 W37 G41 T42 K46 G47 S48 K50 K51 K80 P108 I109 H111 N112 G113 C114 K115 P117 K118 R119 P120 R121	H8 S12 P13 N14 N15 I17 S19 G25 N26 V27 L28 W30 G34 T35 K39 G40 S41 K43 K44 K73 P101 I102 H104 N105 G106 C107 K108 P110 K111 R112 P113 R114

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pis, PDBe:7pis, PDBj:7pis
• PDBsum: 7pis
• PubMed: 36171285
• UniProt: Q50296|RS11_MYCPN Small ribosomal subunit protein uS11 (Gene Name=rpsK)