Structure of PDB 7pic Chain J

Receptor sequence
>7picJ (length=114) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
NVSSGIIHVSCSPNNTIVSASDPGGNVLCWASSGTMGFKGSRKKTPYSAG
IAADKVAKTVKEMGMATVKLFVKGTGRGKDTAIRSFANAGLSITEINEKT
PIPHNGCKPPKRPR
3D structure
PDB7pic Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainJ
Resolution9.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J S17 N21 N22 G31 G32 N33 V34 L35 W37 S39 G41 T42 G47 S48 K50 K51 K80 K106 P108 I109 P110 H111 G113 K115 P117 K118 P120 R121 S10 N14 N15 G24 G25 N26 V27 L28 W30 S32 G34 T35 G40 S41 K43 K44 K73 K99 P101 I102 P103 H104 G106 K108 P110 K111 P113 R114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pic, PDBe:7pic, PDBj:7pic
PDBsum7pic
PubMed36171285
UniProtQ50296|RS11_MYCPN Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]