Structure of PDB 7pib Chain J

Receptor sequence
>7pibJ (length=114) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
NVSSGIIHVSCSPNNTIVSASDPGGNVLCWASSGTMGFKGSRKKTPYSAG
IAADKVAKTVKEMGMATVKLFVKGTGRGKDTAIRSFANAGLSITEINEKT
PIPHNGCKPPKRPR
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainJ
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J H15 S17 N21 N22 S26 G32 N33 V34 W37 S39 G41 K46 G47 S48 R49 K51 K80 I109 P110 H111 N112 C114 K115 K118 R121 H8 S10 N14 N15 S19 G25 N26 V27 W30 S32 G34 K39 G40 S41 R42 K44 K73 I102 P103 H104 N105 C107 K108 K111 R114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtQ50296|RS11_MYCPN Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]