Structure of PDB 7pi9 Chain J

Receptor sequence
>7pi9J (length=114) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
NVSSGIIHVSCSPNNTIVSASDPGGNVLCWASSGTMGFKGSRKKTPYSAG
IAADKVAKTVKEMGMATVKLFVKGTGRGKDTAIRSFANAGLSITEINEKT
PIPHNGCKPPKRPR
3D structure
PDB7pi9 Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainJ
Resolution6.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J H15 N21 N22 G32 N33 V34 W37 S39 G41 T42 G47 S48 K50 K51 K80 K106 P108 H111 N112 C114 K118 P120 R121 H8 N14 N15 G25 N26 V27 W30 S32 G34 T35 G40 S41 K43 K44 K73 K99 P101 H104 N105 C107 K111 P113 R114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pi9, PDBe:7pi9, PDBj:7pi9
PDBsum7pi9
PubMed36171285
UniProtQ50296|RS11_MYCPN Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]