Structure of PDB 7pc2 Chain J |
>7pc2J (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] |
DIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKL ERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL |
|
PDB | 7pc2 Epitope convergence of broadly HIV-1 neutralizing IgA and IgG antibody lineages in a viremic controller. |
Chain | J |
Resolution | 2.8 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MAN |
J |
W67 G68 |
W63 G64 |
|
|
|