Structure of PDB 7p7q Chain J

Receptor sequence

>7p7qJ (length=177) Species: 1351 (Enterococcus faecalis)

NRLKEKYIKEVTPSLVEKFNYSSVMQTPKVDKIVINMGVGDAVSNAKNLD
KAVEELALITGQKPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYEFLD
KLVTVSLPRVRDFHGVSKKAFDGRGNYTLGIKEQLIFPEVDYDLVDKVRG
MDIVIVTTANTDEESRELLAQLGMPFQ

3D structure

• PDB: 7p7q Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
• Chain: J
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K33 V35 N37 M38 G39 G41 T68 K71 I74 F77 I85 K88 A121 F122 D123 R125 N127 T129 G131 K133 G151 M152 D153 V155	K32 V34 N36 M37 G38 G40 T67 K70 I73 F76 I84 K87 A120 F121 D122 R124 N126 T128 G130 K132 G150 M151 D152 V154
BS02	rna	J	S24 M26 Q27 Q63 K64 L66 K69 T90 R92	S23 M25 Q26 Q62 K63 L65 K68 T89 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7p7q, PDBe:7p7q, PDBj:7p7q
• PDBsum: 7p7q
• PubMed: 35387982
• UniProt: Q839F2|RL5_ENTFA Large ribosomal subunit protein uL5 (Gene Name=rplE)