Structure of PDB 7ozp Chain J |
>7ozpJ (length=65) Species: 9825 (Sus scrofa domesticus) [Search protein sequence] |
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL AHVDLIEKLLNYAPL |
|
PDB | 7ozp Structure of an inactive RNA polymerase II dimer. |
Chain | J |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C7 C44 C45 |
C7 C44 C45 |
|
|
|
|