Structure of PDB 7oht Chain J

Receptor sequence

>7ohtJ (length=169) Species: 559292 (Saccharomyces cerevisiae S288C)

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

• PDB: 7oht Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Chain: J
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	V18 N20 S22 V23 G24 R51 R55 F57 I59 R61 A66 H68 N95 S97 T99 G105 D107 G124 M125 Y128 K142	V13 N15 S17 V18 G19 R46 R50 F52 I54 R56 A61 H63 N90 S92 T94 G100 D102 G119 M120 Y123 K137
BS02	rna	J	P8 M9 R10 Q43 T44 V46 T70 R72 G135 R137 V138 R140 R141 R143 G146 T147 V148 G149 H152	P3 M4 R5 Q38 T39 V41 T65 R67 G130 R132 V133 R135 R136 R138 G141 T142 V143 G144 H147

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oht, PDBe:7oht, PDBj:7oht
• PDBsum: 7oht
• PubMed: 34813592
• UniProt: P0C0W9|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)