Structure of PDB 7of4 Chain J

Receptor sequence
>7of4J (length=140) Species: 9606 (Homo sapiens) [Search protein sequence]
GVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLP
TKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHV
YEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVK
3D structure
PDB7of4 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
ChainJ
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J R21 A22 I23 V38 Q41 R42 K69 V87 S88 K99 G100 A101 R102 Q103 T104 G105 D134 S139 R142 S143 G146 S147 S150 L151 R4 A5 I6 V21 Q24 R25 K52 V70 S71 K82 G83 A84 R85 Q86 T87 G88 D117 S122 R125 S126 G129 S130 S133 L134
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7of4, PDBe:7of4, PDBj:7of4
PDBsum7of4
PubMed34135319
UniProtQ9Y3B7|RM11_HUMAN Large ribosomal subunit protein uL11m (Gene Name=MRPL11)

[Back to BioLiP]