Structure of PDB 7nvz Chain J |
>7nvzJ (length=64) Species: 9823 (Sus scrofa) [Search protein sequence] |
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL AHVDLIEKLLNYAP |
|
PDB | 7nvz Structures of mammalian RNA polymerase II pre-initiation complexes. |
Chain | J |
Resolution | 7.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C7 C44 C45 |
C7 C44 C45 |
|
|
|
|