Structure of PDB 7nhk Chain J

Receptor sequence

>7nhkJ (length=176) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

NRLKEKYIKEVTPSLVEKFNYSSVMQTPKVDKIVINMGVGDAVSNAKNLD
KAVEELALITGQKPLITKAKKSIAGFRLREGMPIGAKVTLRGERMYEFLD
KLVTVSLPRVRDFHGVSKKAFDGRGNYTLGIKEQLIFPEVDYDLVDKVRG
MDIVIVTTANTDEESRELLAQLGMPF

3D structure

PDB

7nhk Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	N37 G39 V40 G41 T68 K71 K72 I74 F77 I85 K88 F122 D123 T129 L130 G131 K133 R150 G151 M152 D153	N36 G38 V39 G40 T67 K70 K71 I73 F76 I84 K87 F121 D122 T128 L129 G130 K132 R149 G150 M151 D152
BS02	rna	J	S24 M26 Q27 K30 Q63 K64 L66 T90 R92	S23 M25 Q26 K29 Q62 K63 L65 T89 R91

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nhk, PDBe:7nhk, PDBj:7nhk
PDBsum	7nhk
PubMed	34117249
UniProt	A0A1B4XKS2

[Back to BioLiP]