Structure of PDB 7m76 Chain J

Receptor sequence
>7m76J (length=41) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL
3D structure
PDB7m76 Room temperature XFEL crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem I.
ChainJ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J Y7 P12 Y7 P12
BS02 CLA J F29 N30 D35 L36 F29 N30 D35 L36
BS03 CLA J W18 M19 T22 W18 M19 T22
BS04 CLA J I21 E28 R31 I21 E28 R31
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m76, PDBe:7m76, PDBj:7m76
PDBsum7m76
PubMed34750381
UniProtP0A429|PSAJ_THEVB Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]