Structure of PDB 7f0d Chain J

Receptor sequence

>7f0dJ (length=146) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence]

PTYAPKAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDGG
DFVIVINADKVAISGDKLQHKMVYRHSGYPGGLHKRTIGELMQRHPDRVV
EKAILGMLPKNRLSRQIQRKLRVYAGPEHPHSAQQPVPYELKQVAQ

3D structure

PDB

7f0d Cryo-EM structure of Mycobacterium tuberculosis 50S ribosomal subunit bound with clarithromycin reveals dynamic and specific interactions with macrolides.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K7 A8 W15 V24 G26 R27 V30 N34 R37 K39 P46 N47 F53 K68 K72 Y75 R76 H77 S78 Y80 P81 G82 L84 H85 E102 K103 A104 G107 M108 N112 R113 L114 R116 H132 A134 Q144 Q147	K6 A7 W14 V23 G25 R26 V29 N33 R36 K38 P45 N46 F52 K67 K71 Y74 R75 H76 S77 Y79 P80 G81 L83 H84 E101 K102 A103 G106 M107 N111 R112 L113 R115 H131 A133 Q143 Q146

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f0d, PDBe:7f0d, PDBj:7f0d
PDBsum	7f0d
PubMed	34935599
UniProt	A5U8B9\|RL13_MYCTA Large ribosomal subunit protein uL13 (Gene Name=rplM)

[Back to BioLiP]