Structure of PDB 7ewk Chain J

Receptor sequence
>7ewkJ (length=42) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]
MRDIKTYLSVAPVLSTLWFGALAGLLIEINRLFPDALSFPFF
3D structure
PDB7ewk Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.
ChainJ
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J A11 L14 S15 W18 A11 L14 S15 W18
BS02 CLA J D35 A36 D35 A36
BS03 CLA J W18 L22 W18 L22
BS04 CLA J E28 R31 L32 E28 R31 L32
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ewk, PDBe:7ewk, PDBj:7ewk
PDBsum7ewk
PubMed34879391
UniProtA1E9L0|PSAJ_HORVU Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]