Structure of PDB 7ecw Chain J |
>7ecwJ (length=124) Species: 1647551 (Moraxella phage Mcat5) [Search protein sequence] |
MKKIEMIEISQNRQNLTAFLHISEIKAINAKLADGVDVDKKSFDEICSIV LEQYQAKQISNKQASEIFETLAKANKSFKIEKFRCSHGYNEIYKYSPDHE AYLFYCKGGQGQLNKLIAENGRFM |
|
PDB | 7ecw Insights into the dual functions of AcrIF14 during the inhibition of type I-F CRISPR-Cas surveillance complex. |
Chain | J |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
J |
Y89 K107 |
Y89 K107 |
|
|
|