Structure of PDB 7dz7 Chain J

Receptor sequence
>7dz7J (length=41) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
MKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFSF
3D structure
PDB7dz7 Structural basis of LhcbM5-mediated state transitions in green algae.
ChainJ
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J A11 P12 T16 F19 T20 A11 P12 T16 F19 T20
BS02 CLA J D35 P36 L37 D35 P36 L37
BS03 CLA J I14 W18 I14 W18
BS04 CLA J W18 F19 T22 L26 W18 F19 T22 L26
BS05 CLA J F21 L25 E28 R31 Y32 F21 L25 E28 R31 Y32
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dz7, PDBe:7dz7, PDBj:7dz7
PDBsum7dz7
PubMed34239095
UniProtP59777|PSAJ_CHLRE Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]