Structure of PDB 7blx Chain J

Receptor sequence
>7blxJ (length=39) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
MKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVF
3D structure
PDB7blx Dimeric and high-resolution structures of Chlamydomonas Photosystem I from a temperature-sensitive Photosystem II mutant
ChainJ
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J I14 I17 W18 I14 I17 W18
BS02 CLA J A11 P12 T16 F19 A11 P12 T16 F19
BS03 CLA J W18 F19 T22 L26 W18 F19 T22 L26
BS04 CLA J F21 G24 L25 E28 R31 Y32 F21 G24 L25 E28 R31 Y32
BS05 C7Z J Y7 P12 T16 I27 E28 R31 Y7 P12 T16 I27 E28 R31
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7blx, PDBe:7blx, PDBj:7blx
PDBsum7blx
PubMed
UniProtP59777|PSAJ_CHLRE Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]