Structure of PDB 7aoh Chain J |
>7aohJ (length=61) Species: 502057 (Vaccinia virus GLV-1h68) [Search protein sequence] |
VFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQ RNLTVQPLLDI |
|
PDB | 7aoh Structural basis of the complete poxvirus transcription initiation process. |
Chain | J |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.7.6: DNA-directed RNA polymerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C7 C10 C39 C40 |
C6 C9 C38 C39 |
|
|
|
|