Structure of PDB 7aoc Chain J

Receptor sequence
>7aocJ (length=68) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMIL
THVDLIEKLLCYNPLSKQ
3D structure
PDB7aoc Conserved strategies of RNA polymerase I hibernation and activation.
ChainJ
Resolution3.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN J C10 C44 C45 C10 C44 C45
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001055 RNA polymerase II activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006360 transcription by RNA polymerase I
GO:0006362 transcription elongation by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006383 transcription by RNA polymerase III
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005665 RNA polymerase II, core complex
GO:0005666 RNA polymerase III complex
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex
GO:0005829 cytosol
GO:0016591 RNA polymerase II, holoenzyme

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aoc, PDBe:7aoc, PDBj:7aoc
PDBsum7aoc
PubMed33536435
UniProtO13877|RPAB5_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC5 (Gene Name=rpb10)

[Back to BioLiP]