Structure of PDB 6zzy Chain J

Receptor sequence
>6zzyJ (length=41) Species: 2649997 (Chlorella ohadii) [Search protein sequence]
MKDFTTYLSTAPVLTLLSVTVVAGLLIEINRFFPDALIAAF
3D structure
PDB6zzy Cryo-EM photosystem I structure reveals adaptation mechanisms to extreme high light in Chlorella ohadii.
ChainJ
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J P31 T34 S37 V41 P12 T15 S18 V22
BS02 CLA J A55 L56 A36 L37
BS03 CLA J L44 E47 R50 L25 E28 R31
BS04 RRX J Y26 P31 V32 L35 I46 E47 R50 Y7 P12 V13 L16 I27 E28 R31
BS05 LPX J T24 S28 T5 S9
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zzy, PDBe:6zzy, PDBj:6zzy
PDBsum6zzy
PubMed34462576
UniProtW8SUD1

[Back to BioLiP]