Structure of PDB 6ywv Chain J

Receptor sequence

>6ywvJ (length=243) Species: 367110 (Neurospora crassa OR74A)

ASILASLSDNRGAYHKRIRKGRGPSSGYGKTAGRGTKGQKAHGHVKPWFQ
GGQTPLIVSHGRKGFVNQFAADMSELNLEKLQEWIEAGRIDPTKPITPKE
IIKSGIIGSSIKDGIKLLGRGKESFKIPVTITVSRASASAIEAIEAAGGK
IVTRFYTKESLKRLVEGKSLHTDKPLPVGKEHVEEILAQARSLKKKYYRL
PDPTSRWDIEYYRDPAHRGYLSHQLAPGESPSLYFKVPTGGEK

3D structure

• PDB: 6ywv Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
• Chain: J
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	A51 L53 N56 G58 A59 Y60 H61 K62 R63 I64 R65 K66 G67 R68 G69 S71 S72 Y74 G75 K76 T77 A78 G79 R80 G81 K83 G84 Q85 K86 H88 K92 P93 W94 F95 Q96 G97 Q99 T100 L102 V104 S105 H106 K109 G110 F111 N113 F115 E121 N123 K126 W130 R135 K149 S155 K162 L164 G165 R166 R181 S183 A184 S185 R209 E212 Y244 R245 P247 D248 T250 S251 R252 W253 Y257	A5 L7 N10 G12 A13 Y14 H15 K16 R17 I18 R19 K20 G21 R22 G23 S25 S26 Y28 G29 K30 T31 A32 G33 R34 G35 K37 G38 Q39 K40 H42 K46 P47 W48 F49 Q50 G51 Q53 T54 L56 V58 S59 H60 K63 G64 F65 N67 F69 E75 N77 K80 W84 R89 K103 S109 K116 L118 G119 R120 R135 S137 A138 S139 R163 E166 Y198 R199 P201 D202 T204 S205 R206 W207 Y211

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ywv, PDBe:6ywv, PDBj:6ywv
• PDBsum: 6ywv
• PubMed: 33056988
• UniProt: Q7SB98|RM10_NEUCR Large ribosomal subunit protein uL15m (Gene Name=mrpl10)