Structure of PDB 6yez Chain J

Receptor sequence
>6yezJ (length=42) Species: 3888 (Pisum sativum) [Search protein sequence]
MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF
3D structure
PDB6yez The structure of a triple complex of plant photosystem I with ferredoxin and plastocyanin.
ChainJ
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J A11 P12 F19 A20 A11 P12 F19 A20
BS02 CLA J I29 N30 D35 A36 I29 N30 D35 A36
BS03 CLA J W18 F19 L22 L26 W18 F19 L22 L26
BS04 CLA J G24 E28 R31 F32 G24 E28 R31 F32
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yez, PDBe:6yez, PDBj:6yez
PDBsum6yez
PubMed33020607
UniProtD5MAL3

[Back to BioLiP]