Structure of PDB 6xe0 Chain J

Receptor sequence

>6xe0J (length=117) Species: 83333 (Escherichia coli K-12)

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

• PDB: 6xe0 Escherichia coli NusG Links the Lead Ribosome with the Transcription Elongation Complex.
• Chain: J
• Resolution: 6.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	R12 H21 N27 N28 T32 G38 N39 A40 W43 T45 G47 G48 R52 G53 S54 K56 K86 E93 H117 N118 G119 C120 R121 P123 K124 K125 R126 R127 V128	R1 H10 N16 N17 T21 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 K75 E82 H106 N107 G108 C109 R110 P112 K113 K114 R115 R116 V117

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xe0, PDBe:6xe0, PDBj:6xe0
• PDBsum: 6xe0
• PubMed: 32726726
• UniProt: P0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)