Structure of PDB 6wu6 Chain J

Receptor sequence

>6wu6J (length=238) Species: 562 (Escherichia coli)

MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLS
FRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVI
RDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECI
LCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDA
FSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA

3D structure

• PDB: 6wu6 A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
• Chain: J
• Resolution: 3.6 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	J	S54 C55 G58 C60 S62 D63 C75	S54 C55 G58 C60 S62 D63 C75
BS02	SF4	J	C149 I150 L151 C152 C155 A173 C216 P217 L220	C149 I150 L151 C152 C155 A173 C216 P217 L220
BS03	F3S	J	C159 S161 F169 P172 C206 S208 I209 M210 C212	C159 S161 F169 P172 C206 S208 I209 M210 C212

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0019646 aerobic electron transport chain
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:6wu6, PDBe:6wu6, PDBj:6wu6
• PDBsum: 6wu6
• PubMed: 33408407
• UniProt: P07014|SDHB_ECOLI Succinate dehydrogenase iron-sulfur subunit (Gene Name=sdhB)