Structure of PDB 6trd Chain J

Receptor sequence
>6trdJ (length=41) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL
3D structure
PDB6trd Current limits of structural biology: The transient interaction between cytochrome c6 and photosystem I
ChainJ
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J M19 A23 M19 A23
BS02 CLA J F29 N30 D35 L36 L37 F29 N30 D35 L36 L37
BS03 CLA J L14 W18 L14 W18
BS04 CLA J W18 M19 T22 W18 M19 T22
BS05 CLA J E28 F32 E28 F32
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6trd, PDBe:6trd, PDBj:6trd
PDBsum6trd
PubMed
UniProtP0A429|PSAJ_THEVB Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]