Structure of PDB 6tc2 Chain J

Receptor sequence
>6tc2J (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB6tc2 Insulin polymorphism induced by two polyphenols: new crystal forms and advances in macromolecular powder diffraction.
ChainJ
Resolution1.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide J F1 V2 Q4 F1 V2 Q4
BS02 peptide J S9 H10 S9 H10
BS03 peptide J Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 T30 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 T30
BS04 peptide J G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28 G8 S9 V12 E13 Y16 G23 F24 F25 Y26 P28
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6tc2, PDBe:6tc2, PDBj:6tc2
PDBsum6tc2
PubMed33135678
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]