Structure of PDB 6spd Chain J

Receptor sequence

>6spdJ (length=141) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]

KTYTAKPETVQRDWFVVDAAGQTLGRLATEIARRLRGKHKPEYTPHVDTG
DYIVVINAEQVRVTGAKTTDKMYYHHSGFPGGIKSINFEKLIAKAPERVI
ETAVKGMLPKNPLGRDMYRKLKVYKGASHPHTAQQPQELKI

3D structure

PDB

6spd Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.

Chain

Resolution

3.28 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K2 T3 P8 G26 R27 T30 R37 K39 H47 Y53 K68 K72 Y75 H77 S78 F80 G82 K85 K95 A104 M108 N112 P113 L114 R116 R120 H132 A134 Q135 Q136	K1 T2 P7 G25 R26 T29 R36 K38 H46 Y52 K67 K71 Y74 H76 S77 F79 G81 K84 K94 A103 M107 N111 P112 L113 R115 R119 H131 A133 Q134 Q135

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links