Structure of PDB 6rqf Chain J

Receptor sequence

>6rqfJ (length=160) Species: 3562 (Spinacia oleracea)

MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIAC
NVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLL
MASVPAGLLTVPFLENVNKFQNPFRRPVATTVFLVGTVVALWLGIGATLP
IDKSLTLGLF

3D structure

• PDB: 6rqf Cryo-EM structure of the spinach cytochrome b6f complex at 3.6 angstrom resolution.
• Chain: J
• Resolution: 3.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	J	D35 L57	D35 L57
BS02	CLA	J	Y80 L108 F133 G136 V139	Y80 L108 F133 G136 V139

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0042651 thylakoid membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:6rqf, PDBe:6rqf, PDBj:6rqf
• PDBsum: 6rqf
• PubMed: 31723268
• UniProt: P00166|PETD_SPIOL Cytochrome b6-f complex subunit 4 (Gene Name=petD)