Structure of PDB 6ppk Chain J

Receptor sequence

>6ppkJ (length=141) Species: 1423 (Bacillus subtilis)

TPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGD
HVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLE
LAIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELR

3D structure

• PDB: 6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
• Chain: J
• Resolution: 4.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T4 P5 W16 G27 R38 K40 H48 T66 K69 K73 Y76 R77 H78 T79 H81 G83 L85 K86 Y97 E103 A105 M109 P111 G113 S114 L115 R117 K121 K122 P132 H133 A135 Q136 K137 R144	T1 P2 W13 G24 R35 K37 H45 T63 K66 K70 Y73 R74 H75 T76 H78 G80 L82 K83 Y94 E100 A102 M106 P108 G110 S111 L112 R114 K118 K119 P129 H130 A132 Q133 K134 R141

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
• PDBsum: 6ppk
• PubMed: 31665744
• UniProt: P70974|RL13_BACSU Large ribosomal subunit protein uL13 (Gene Name=rplM)