Structure of PDB 6ppf Chain J

Receptor sequence
>6ppfJ (length=141) Species: 1423 (Bacillus subtilis) [Search protein sequence]
TPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGD
HVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLE
LAIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELR
3D structure
PDB6ppf Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainJ
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J P5 R14 G27 R28 S31 R38 K40 H48 T66 K69 K73 Y76 R77 H78 H81 L85 K86 R88 A105 M109 K112 S114 L115 K121 A135 Q136 K137 P2 R11 G24 R25 S28 R35 K37 H45 T63 K66 K70 Y73 R74 H75 H78 L82 K83 R85 A102 M106 K109 S111 L112 K118 A132 Q133 K134
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppf, PDBe:6ppf, PDBj:6ppf
PDBsum6ppf
PubMed31665744
UniProtP70974|RL13_BACSU Large ribosomal subunit protein uL13 (Gene Name=rplM)

[Back to BioLiP]