Structure of PDB 6nwa Chain J

Receptor sequence
>6nwaJ (length=39) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFH
3D structure
PDB6nwa The structure of the stress-induced photosystem I-IsiA antenna supercomplex.
ChainJ
Resolution3.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J A11 P12 A11 P12
BS02 CLA J M16 A17 M16 A17
BS03 CLA J M14 I15 L18 M14 I15 L18
BS04 CLA J N30 L36 N30 L36
BS05 CLA J L18 T22 L18 T22
BS06 CLA J G24 I25 E28 R31 F32 G24 I25 E28 R31 F32
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nwa, PDBe:6nwa, PDBj:6nwa
PDBsum6nwa
PubMed31133699
UniProtQ55329|PSAJ_SYNY3 Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]